PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010092004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family HSF
Protein Properties Length: 125aa    MW: 13976.9 Da    PI: 4.0294
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010092004.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind75.41e-2348106260
                     HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
    HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 
                     Fl+k++++++d++++ +isw ++g sfvv+d+ efa+ vLp+ Fkh+nf+SFvRQLn+Y
  XP_010092004.1  48 FLSKTFDLVDDPAIDAIISWGSTGGSFVVWDPVEFARLVLPRNFKHNNFSSFVRQLNTY 106
                     9*********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.102.9E-2543106IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004151.8E-2044125IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467855.44E-2446106IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000564.6E-134871IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004472.7E-2048106IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000564.6E-138698IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000564.6E-1399111IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    Send to blast
MAELDPTLFM DAFPYSESPM FEFEAEENKP VVVPQPLECL QGNPIPPFLS KTFDLVDDPA  60
IDAIISWGST GGSFVVWDPV EFARLVLPRN FKHNNFSSFV RQLNTYVGIF SCYTALKCSG  120
FADVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ldu_A3e-18451061778Heat shock factor protein 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010092004.12e-88Heat stress transcription factor A-3
RefseqXP_010096858.12e-88Heat stress transcription factor A-3
SwissprotQ8GYY14e-40HSFA3_ARATH; Heat stress transcription factor A-3
TrEMBLW9T1P52e-88W9T1P5_9R
STRINGscaffold_600303.19e-38(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15923395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03720.12e-41heat shock transcription factor A3